The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283358
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19672,TM1501 Molecular Weight 11636.10 Da.
    Residues 102 Isoelectric Point 9.59
    Sequence mpgqkiriklkaydhelldesakkivevakstnskvsgpiplptertlycvlrspmkhkdsrehfekrv hkrlidiidpspktidalmrinlpagvdveikl
      BLAST   FFAS

    Ligand Information
    Model TM1501
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch