The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 283376
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS26400,TM1519 Molecular Weight 25281.22 Da.
    Residues 236 Isoelectric Point 5.46
    Sequence mseldareiiemiakakkktpivayikgdlagidfssfkffgderfgilfgeyedfkklleehrekied yhlevkarnsalpladltkykariepgaiirdmveigegavimmgavinvgavigegtmidmnavvggr aiigkkchigagaviagvieppsakpvviedevlvganavilegvtvgkgavvaagavvtkdvppytvv agvparvikqidektkektkivdelrnle
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1519

    Name: "L-2,3,4,5-tetrahydrodipicolinate N2-acetyltransferase"
    Metabolic Subsystem: Lysine Biosynthesis
    Reaction: : accoa + h2o + thdp --> coa + nal2a6o
    Classification: EC:

    Ligand Information
    Model TM1519
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch