.
The Open Protein Structure Annotation Network
PDB Keyword
.

283379

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 283379
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS26338,TM1522, _0026.000490_ Molecular Weight 26872.35 Da.
    Residues 236 Isoelectric Point 5.28
    Sequence mcysangntflivdntqkripeekkpdfvrenvgdldgvifvelvdgkyfmdyynrdgsmaafcgngar afsqylidrgwikekeftflsrageikvivddsiwvrmpgvsekkemkvdgyegyfvvvgvphfvmevk gideldveklgrdlryktganvdfyevlpdrlkvrtyergveretkacgtgvtsvfvvyrdktgakevk iqvpggtlflkeengeiflrgdvkrcsee
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1522

    Name: diaminopimelate epimerase
    Metabolic Subsystem: Lysine Biosynthesis
    Reaction: : 26dap-LL <==> 26dap-M
    Classification: EC:5.1.1.7
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1522
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch