.
The Open Protein Structure Annotation Network
PDB Keyword
.

283382

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283382
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS26412,TM1525, 89440 Molecular Weight 31732.52 Da.
    Residues 274 Isoelectric Point 4.66
    Sequence mrwavllmvvfsallfssevvltsvgatdisfngfpvtmelnfwnvksyegetwlkfdgekvefyadly nivlqnpdswvhgypeiyygykpwaghnsgveflpvkvkdlpdfyvtldysiwyennlpinlametwit rspdqtsvssgdaeimvwfynnvlmpggqkvdeftttveingvkqetkwdvyfapwgwdylafrlttpm kegkvkinvkdfvqkaaevvkkhstridnfeelyfcvweigtefgdpnttaakfgwtfrdfsvevvk
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1525

    Name: "endoglucanase (beta-1,4 glc) (extracellular)"
    Other genes that carryout this rxn:TM0305
    Metabolic Subsystem: Cellulose Metabolism
    Reaction: : cell500 + h2o --> cell4

     
    Name: "glucan hydrolysis by beta-1,4- and beta-1,3 glucosidase"
    Other genes that carryout this rxn: TM0305
    Metabolic Subsystem: Glucan Metabolism
    Reaction: : glucan1500 + h2o --> glucan4

     
    Name: "glucan hydrolysis by beta-1,4- and beta-1,3 glucosidase"
    Other genes that carryout this rxn: TM0305
    Metabolic Subsystem: Glucan Metabolism
    Reaction: : glucan1500 + h2o --> glucan4 + glucan6

     
    Name: "glucan hydrolysis by beta-1,4- and beta-1,3 glucosidase"
    Other genes that carryout this rxn:TM0305
    Metabolic Subsystem: Glucan Metabolism
    Reaction: : glucan1500 + h2o --> glucan6

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1525
    generated 12/2008
    Transmembrane protein

    HMM_TM1525

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch