The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 283424
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2301,TM1567, BIG_191, 85074 Molecular Weight 8493.64 Da.
    Residues 75 Isoelectric Point 5.42
    Sequence mkellekilrgivkhpeevvvmefdeegkkvyeivvneedvgqvigkdgrtikslkillsalmgdskei tikvvr
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch