.
The Open Protein Structure Annotation Network
PDB Keyword
.

283441

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 283441
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19740,TM1584 Molecular Weight 23574.98 Da.
    Residues 202 Isoelectric Point 8.66
    Sequence mlnylfenncllcgkevsplrslcenceekvlkngpsfyrevhrkyelfvysdytdeieriirlykyhg evslsgtlvklflklysyfpreanlitwvpssldsledrgfdhmrllakriskelgipfdavlenvseg rqvekskeerkrtgrfickkdppqnviliddvlttgtsvrdcvetlfrngvskvfvyvlaktrr
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch