.
The Open Protein Structure Annotation Network
PDB Keyword
.

283468

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283468
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19762,TM1611, 282186 Molecular Weight 31909.40 Da.
    Residues 273 Isoelectric Point 7.75
    Sequence mlqikrkinatqslmkitramemvarakvrkieseyqkfkpfydevkrlwalvpaesldpiffeegnrd livvitsdmglcgsfnseilreaervisesrdphlilvglkainhfkdgkvlkmydrfyeipdfrngst ivedilnfldgkparvrvifsrfknvliqrpevhellpikkeekkredfeyeprleqiaplifhyylsa tlmelmfqtkigeyyarqnamknatdnaqevireltlaynkarqasitqelieivtgaealkeiek
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1611

    Name: H+-exporting ATPase
    Other genes that carryout this rxn:TM1616 TM1614 TM1612 TM1609 TM1615 T
    Metabolic Subsystem: Energy Metabolism
    Reaction: atp[c] + h[c] + h2o[c] --> adp[c] + h[e] + pi[c]
    Classification: EC:3.6.3.6
     
    Name: ATP synthase (10 protons for three ATP)
    Other genes that carryout this rxn:TM1616 TM1614 TM1612 TM1609 TM1615 T
    Metabolic Subsystem: Energy Metabolism
    Reaction: adp[c] + h[e] + pi[c] --> atp[c] + h[c] + h2o[c]
    Classification: EC:3.6.3.14
     
    Name: ATP synthase (four protons for one ATP)
    Other genes that carryout this rxn:TM1616 TM1614 TM1612 TM1609 TM1615 T
    Metabolic Subsystem: Energy Metabolism
    Reaction: adp[c] + h[e] + pi[c] --> atp[c] + h[c] + h2o[c]
    Classification: EC:3.6.3.14
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1611
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch