.
The Open Protein Structure Annotation Network
PDB Keyword
.

283471

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283471
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19766,TM1614 Molecular Weight 19294.32 Da.
    Residues 164 Isoelectric Point 5.44
    Sequence mgfleinwtsaamlmlfvlmvyflnkflytpfiemaekrrkkveedlksaeqlkeeaekmrseaerfls earqradeivesarkeaeaiveearekakkeaqnivesaktqieveykkaleqvqeraaelsvilatkl lqkvfqderarreylvkilkeeieks
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1614

    Name: H+-exporting ATPase
    Other genes that carryout this rxn:TM1616 TM1611 TM1612 TM1609 TM1615 T
    Metabolic Subsystem: Energy Metabolism
    Reaction: atp[c] + h[c] + h2o[c] --> adp[c] + h[e] + pi[c]
    Classification: EC:3.6.3.6
     
    Name: ATP synthase (10 protons for three ATP)
    Other genes that carryout this rxn:TM1616 TM1611 TM1612 TM1609 TM1615 T
    Metabolic Subsystem: Energy Metabolism
    Reaction: adp[c] + h[e] + pi[c] --> atp[c] + h[c] + h2o[c]
    Classification: EC:3.6.3.14
     
    Name: ATP synthase (four protons for one ATP)
    Other genes that carryout this rxn:TM1616 TM1611 TM1612 TM1609 TM1615 T
    Metabolic Subsystem: Energy Metabolism
    Reaction: adp[c] + h[e] + pi[c] --> atp[c] + h[c] + h2o[c]
    Classification: EC:3.6.3.14
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1614
    generated 12/2008
    Transmembrane protein

    HMM_TM1614

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch