The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 283493
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19778,TM1636, BIG_672 Molecular Weight 99996.32 Da.
    Residues 852 Isoelectric Point 5.86
    Sequence mrperltvrnflglknvdiefqsgitvvegpngagksslfeaisfalfgngirypnsydyvnrnavdgt arlvfqferggkryeiireinalqrkhnaklseilengkkaaiaakptsvkqevekilgiehrtfirtv flpqgeidkllisppseiteiisdvfqsketleklekllkekmkkleneisslqalytaiwkyleendl evlkselktvsekkkellkkreelqkeeeqlkrllekyrelvkkkerlrvlslrrnelqkeviyeqkvk kakeleplfreiylrqreferfsqelnsrekrykelesekeaiskeipvhrerlskleeigekikeeld llekvlkasrplleqrirlkenltrleeefrrlvgekekrekellsiektenetkneleklldelsilk kdhmkwlayqiasslnegdtcpvcggvfhgkveavefnidefekldqkrselentlnvlkerkkslssl iedllmkieegkknlksirnqiekieeelhrlgysedleekldekrkklrkieeerhsisqkitaadvq isqienqlkeikgeieakretlkeqreemdqlksdffdrlrkigigfeefrilvkeevkdaekelgvve teirlleeslkelesenvrdvsedyekvrnqlealsqeisdlerkegrlnhlieetlrrerelkslekk lkemsdeynnldllrkylfdksnfsryftgrvleavlkrtkayldiltngrfdidfddekggfiikdwg ierparglsggeralisislamslaevasgrldaffidegfssldtenkekiasvlkelerlnkvivfi thdrefseafdrklritggvvvne
      BLAST   FFAS

    Ligand Information
    Model TM1636
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch