.
The Open Protein Structure Annotation Network
PDB Keyword
.

283505

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283505
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19782,TM1648, BIG_3, 85064 Molecular Weight 22733.16 Da.
    Residues 198 Isoelectric Point 6.62
    Sequence mvvitnelesimerllsrkrinhvrsvvefsrklgemygadsnklelaaishdlfrdvpprkllkmaqa yglkiselerthpvllhgkvaaeflkrrfnvedeevlnavayhtsghvsfktvgkilfiadsleftrdf pgvdelrriafrnleegffqvlknkifyavgknyllipetvelwnsilmgrgglvdeeve
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch