The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 283515
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19792,TM1658 Molecular Weight 43670.68 Da.
    Residues 395 Isoelectric Point 5.28
    Sequence mrrlftsesvteghpdkiadqisdaildamleqdprsrvavetlvttglviiagevttrayveipdiar ktileigytrakygfdgetcgvltsihsqspdialgvdkalevktgeevadefealgagdqgimfgyat netpeymplpitlahklamrlaevrkngtlpflrpdgktqvtieyeddkpvrvdtvlistqhdpdisqa dlreaiiehvinpvipeqyrddkmkilvnptgrfvlggpmadtgltgrkiivdtyggwvphgggafsgk dptkvdrsahymaryvaknvvaagladkfliqlsyaigvakpvsimidtygtakvdedkllkvitelfd frpgaiikklnllrpiyrktaayghfgrneeeftwekldmvdelkrafnm
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1658

    Name: methionine adenosyltransferase
    Metabolic Subsystem: Methionine Metabolism
    Reaction: : atp + h2o + met-L --> amet + pi + ppi
    Classification: EC:

    Ligand Information
    Model TM1658
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch