.
The Open Protein Structure Annotation Network
PDB Keyword
.

283546

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 283546
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19814,TM1689, 85045 Molecular Weight 24035.51 Da.
    Residues 207 Isoelectric Point 6.93
    Sequence mkgqlfvicgpsgagktsiikevlkrldnvvfsvscttrpkrpheedgkdyffiteeeflkrvergefl ewarvhghlygtlrsfveshinegkdvvldidvqgalsvkkkysntvfiyvappsyadlrerilkrgte keadvlvrlenakwelmfmdefdyivvnenledavemvvsivrserakvtrnqdkierfkmevkgwkkl
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1689

    Name: guanylate kinase (GMP:ATP)
    Metabolic Subsystem: Purine Metabolism
    Reaction: : atp + gmp <==> adp + gdp
    Classification: EC:2.7.4.8
     
    Name: adentylate kinase (GTP)
    Metabolic Subsystem: Purine Metabolism
    Reaction: : amp + gtp <==> adp + gdp

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1689
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch