.
The Open Protein Structure Annotation Network
PDB Keyword
.

283570

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283570
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19826,TM1714, 89487 Molecular Weight 32250.88 Da.
    Residues 284 Isoelectric Point 8.62
    Sequence mfeklschtsikiggrvkylvlpndvfsleraitvlkdlpfqimglgtnllvqdedldiavlkterlnq ieikgekvlvesgtplkrlclflmeaelgglefaygipgsvggaiymnagayggeigefveavevlrdg ektwlsrneiffgyrdstfkrekliitrvmmsfkkekketikakmddymrrrlekqpldlpsagsvfkr predfyvgkaieslglkgyriggaqisekhagfivnagsatfddvmklidfvrkkvkekygveleteve iwwngrrw
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1714

    Name: UDP-N-acetylenolpyruvoylglucosamine reductase
    Metabolic Subsystem: Peptidoglycan Biosynthesis
    Reaction: : h + nadph + uaccg --> nadp + uamr
    Classification: EC:1.1.1.158
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1714
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch