.
The Open Protein Structure Annotation Network
PDB Keyword
.

283592

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 283592
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19834,TM1737, 89488 Molecular Weight 33370.06 Da.
    Residues 299 Isoelectric Point 5.34
    Sequence mksmwcihdriflkktrevfdvdikaykervekaveylkgqidetpeiaiilgsglsviadevekegts kkipyseipgfpistapghkgelifgklfgknvmlmngrfhyyegysmkevtfpirvmqllgveilivt naagglnpdfevgrpmiitdhinfmgdnpligpnvdewgprfpdmsepydkelielaynsarelgipvy qgvyvavtgpcfetpaelrmlrkfgadavgmstvpevivarhgqirvlgisaitdravpedlkpltaee vlevaektgrkiaqiifevvrkl
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1737

    Name: nucleotide phosphatase
    Other genes that carryout this rxn: TM1596
    Metabolic Subsystem: NAD Metabolism
    Reaction: : h + nac + r1p <==> nicrns + pi
    Classification: EC:2.4.2.1
     
    Name: purine-nucleoside phosphorylase
    Other genes that carryout this rxn: TM1596
    Metabolic Subsystem: NAD Metabolism
    Reaction: : pi + rnam <==> h + ncam + r1p
    Classification: EC:2.4.2.1
     
    Name: purine-nucleoside phosphorylase (Guanosine)
    Other genes that carryout this rxn: TM1596
    Metabolic Subsystem: Purine Metabolism
    Reaction: : gsn + pi <==> gua + r1p
    Classification: EC:2.4.2.1
     
    Name: purine-nucleoside phosphorylase (Inosine)
    Other genes that carryout this rxn: TM1596
    Metabolic Subsystem: Purine Metabolism
    Reaction: : ins + pi <==> hxan + r1p
    Classification: EC:2.4.2.1
     
    Name: purine-nucleoside phosphorylase (Adenosine)
    Other genes that carryout this rxn: TM1596
    Metabolic Subsystem: Purine Metabolism
    Reaction: : adn + pi <==> ade + r1p
    Classification: EC:2.4.2.1
     
    Name: purine-nucleoside phosphorylase (Deoxyadenosine)
    Other genes that carryout this rxn: TM1596
    Metabolic Subsystem: Purine Metabolism
    Reaction: : dad-2 + pi <==> 2dr1p + ade
    Classification: EC:2.4.2.1
     
    Name: purine-nucleoside phosphorylase (Deoxyguanosine)
    Other genes that carryout this rxn: TM1596
    Metabolic Subsystem: Purine Metabolism
    Reaction: : dgsn + pi <==> 2dr1p + gua
    Classification: EC:2.4.2.1
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1737
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch