.
The Open Protein Structure Annotation Network
PDB Keyword
.

283602

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283602
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19840,TM1747 Molecular Weight 37975.25 Da.
    Residues 341 Isoelectric Point 9.39
    Sequence mnsepwdfpglllnmsngvvdmrflkfllkrlltiaismvvvivityvlmwlapgnffelqrvrdaiar vttpddpayqatlkgfeeryglnnplwkqilmylkgavvfkfgpsfsdparniedlikekfpitftlal ssilfalvvgvplgilaalkkntwidytamtvsvigvaipsyvvavflilifsiylgwlptsgwegirt kilptialalgplasvarftrvslldtlnqdfirtayakggddrtvimkhalrpsmiplvtivgpqmay lmvgtvwvenifripglgqlfanaavtrdypllvtstfilaltvmimnlivdvlyaildprikld
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1747

    Name: glucomannan transport via ABC system
    Other genes that carryout this rxn:TM1746 TM1748 TM1750 TM1749
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glcman4[e] + h2o[c] --> adp[c] + glcman4[c] + h[c] + pi[c]

     
    Name: glucomannan transport via ABC system
    Other genes that carryout this rxn:TM1746 TM1748 TM1750 TM1749
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glcman6[e] + h2o[c] --> adp[c] + glcman6[c] + h[c] + pi[c]

     
    Name: galactomannan transport via ABC system
    Other genes that carryout this rxn:TM1746 TM1748 TM1750 TM1749
    Metabolic Subsystem: Transport
    Reaction: atp[c] + galman6[e] + h2o[c] --> adp[c] + galman6[c] + h[c] + pi[c]

     
    Name: galactomannan transport via ABC system
    Other genes that carryout this rxn:TM1746 TM1748 TM1750 TM1749
    Metabolic Subsystem: Transport
    Reaction: atp[c] + galman4[e] + h2o[c] --> adp[c] + galman4[c] + h[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1747
    generated 12/2008
    Transmembrane protein

    HMM_TM1747

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch