The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283603
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19842,TM1748, 89939, 89961 Molecular Weight 31654.05 Da.
    Residues 289 Isoelectric Point 9.74
    Sequence mlrknktesigywkafwlrfkknkmaviggvfvlilialailapyiapypydephyirafegpskdfif gtdalgrdlfsrilyslrnaciigfgsqfvvliiggilgavagfkggwidkfimsivdimfafptflfn vilvtalgrglftiflaigltgwagmarlvrgqvlylknsefveaakaagastfyiirkhilpnmigpi lvnlafgvpgammtesglavigmgvrppmpswgnligegigmmmafphllifpavtfaftlisftflad glrdafnprseis
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1748

    Name: glucomannan transport via ABC system
    Other genes that carryout this rxn:TM1746 TM1750 TM1749 TM1747
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glcman4[e] + h2o[c] --> adp[c] + glcman4[c] + h[c] + pi[c]

    Name: glucomannan transport via ABC system
    Other genes that carryout this rxn:TM1746 TM1750 TM1749 TM1747
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glcman6[e] + h2o[c] --> adp[c] + glcman6[c] + h[c] + pi[c]

    Name: galactomannan transport via ABC system
    Other genes that carryout this rxn:TM1746 TM1750 TM1749 TM1747
    Metabolic Subsystem: Transport
    Reaction: atp[c] + galman6[e] + h2o[c] --> adp[c] + galman6[c] + h[c] + pi[c]

    Name: galactomannan transport via ABC system
    Other genes that carryout this rxn:TM1746 TM1750 TM1749 TM1747
    Metabolic Subsystem: Transport
    Reaction: atp[c] + galman4[e] + h2o[c] --> adp[c] + galman4[c] + h[c] + pi[c]


    Ligand Information
    Model TM1748
    generated 12/2008
    Transmembrane protein


    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch