.
The Open Protein Structure Annotation Network
PDB Keyword
.

283605

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283605
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19846,TM1750, _0000.000765_, BV1071, RER070207000405 Molecular Weight 37150.66 Da.
    Residues 328 Isoelectric Point 9.18
    Sequence mpfdqggikmkpllqtvdlkkyfpqgkrilkavdgisieikegetlglvgesgcgkstlgrtilkllrp dggkiffegkditnlndkemkpyrkkmqiifqdplgslnpqmtvgriiedpliihkigtkkerrkrvee lldmvgigrefinsfphefsggqqqrigiaralalnpkfivcdepvsaldvsiqaqiidlleeiqqkmg isylfiahnlavvehishkvavmylgkiveygdvdkiflnpihpytrallksvpkipwdgqkqrfyslk gelpspidlpkgcrfqtrctekkaicfekepelteveknhfvschlvrsyrg
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1750

    Name: glucomannan transport via ABC system
    Other genes that carryout this rxn:TM1746 TM1748 TM1749 TM1747
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glcman4[e] + h2o[c] --> adp[c] + glcman4[c] + h[c] + pi[c]

     
    Name: glucomannan transport via ABC system
    Other genes that carryout this rxn:TM1746 TM1748 TM1749 TM1747
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glcman6[e] + h2o[c] --> adp[c] + glcman6[c] + h[c] + pi[c]

     
    Name: galactomannan transport via ABC system
    Other genes that carryout this rxn:TM1746 TM1748 TM1749 TM1747
    Metabolic Subsystem: Transport
    Reaction: atp[c] + galman6[e] + h2o[c] --> adp[c] + galman6[c] + h[c] + pi[c]

     
    Name: galactomannan transport via ABC system
    Other genes that carryout this rxn:TM1746 TM1748 TM1749 TM1747
    Metabolic Subsystem: Transport
    Reaction: atp[c] + galman4[e] + h2o[c] --> adp[c] + galman4[c] + h[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1750
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch