.
The Open Protein Structure Annotation Network
PDB Keyword
.

283678

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 283678
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2373,TM1825, 89534 Molecular Weight 17965.79 Da.
    Residues 165 Isoelectric Point 8.01
    Sequence mkvvqgdyrgeglkiavvvprfndlvtskllegaldglkrhgvsdenitvvripgsmeaiytlkrlldl gvhdaiivlgavirgetyhfnvvaneigkavaqfnmtsdipivfgvlttdtleqalnragaksgnkgfe aamvaiemanlrkrlrrdvfesdsngr
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1825

    Name: riboflavin synthase
    Other genes that carryout this rxn:TM1827
    Metabolic Subsystem: Riboflavin Metabolism
    Reaction: : dmlz --> 4r5au + ribflv
    Classification: EC:2.5.1.9
     
    Name: riboflavin synthase
    Other genes that carryout this rxn:TM1827
    Metabolic Subsystem: Riboflavin Metabolism
    Reaction: : 4r5au + db4p --> dmlz + h2o + pi
    Classification: EC:2.5.1.9
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1825
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch