.
The Open Protein Structure Annotation Network
PDB Keyword
.

283679

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283679
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19890,TM1826, _0000.000755_ Molecular Weight 43924.87 Da.
    Residues 388 Isoelectric Point 5.96
    Sequence meelreafeegkpvilidrnreneadfvfpaqlitedvvsffvtygkglfcvtadeedllkrgfvklss nyganyfvpvdwgtgtgisaleraetcrklaegryfhefrypghvtviggigfqrrkghteasleisel agfsrhaviveildekgnshnldyvlklsekfslpvlemddvwrefvkrkllmkkkaeatlptdfgvfk vvsfenhldgkehfaivkepledpvavrihsecvtgdvlsslrcdcgsqlanflrymsahggiliylrq egrgiglsnkiaayslqdkgldtveanrvlgfsederdyapaaqilkalgiervllftnnqrktvglek ygievvetkrlygrvtphnrfylstkmkklgheleeifrevns
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch