.
The Open Protein Structure Annotation Network
PDB Keyword
.

283686

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283686
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19898,TM1833, 282602 Molecular Weight 25625.21 Da.
    Residues 220 Isoelectric Point 5.82
    Sequence msslkkelfwkitialivafvvicvlsifqlyfsgiktardfirnvnntvtsfingyfrkfyvvdvlsr ipevryapyltdeerrkvleiyrifqeadrdiyylysgyenglllindyepaegydprvrpwyraales rpkptggipyrefktkellfsvskvitddegnvtgvisvetllerllsnfphsfdnhetvtepqpltil lqgdrfvvvliil
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1833
    generated 12/2008
    Transmembrane protein

    HMM_TM1833

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch