.
The Open Protein Structure Annotation Network
PDB Keyword
.

283688

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283688
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19900,TM1835 Molecular Weight 55178.12 Da.
    Residues 473 Isoelectric Point 8.14
    Sequence mmypmpswvydsvvyqifpdrffigkgktvedkkdlylkrggviekwgvpprklpgaqhvkifyggdlw giaekvdyfeelginvlyltpiflsdtnhkydtidyfrvdpqfggkraflhllrvlhersmklildgvf nhvgsqhpwfkkakkndpeyvnrfflykdrhrswfdvgslpelnveveevkeyilkvvehylklgidgw rldcghdlgptvnlwinmkvkefsaekylvseiwtypagwdmvdglmnynfrnlvlsyvngetdsigfh lerayretknifgcwnmldshdtprlatmvpdrdlrklavvlqftypgvplvyygteigltggedpecr atmewnrekwdvdlfefykkmirlrrtdpglrfgefvllndsplaflrkaphplqntivvvnpgeekvl vlsipdgkimnttplvdvfsgerfhvdggvvklpllarsfrilkpedlrvgkyrlykrv
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1835

    Name: Maltodextrin glucosidase (maltotriose)
    Other genes that carryout this rxn: TM1438
    Metabolic Subsystem: Maltose Metabolism
    Reaction: : h2o + malttr --> glc-D + malt

     
    Name: Maltodextrin glucosidase (maltotetraose)
    Metabolic Subsystem: Maltose Metabolism
    Reaction: : h2o + maltttr --> glc-D + malttr

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1835
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch