.
The Open Protein Structure Annotation Network
PDB Keyword
.

283697

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 283697
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS26278,TM1845 Molecular Weight 96257.07 Da.
    Residues 843 Isoelectric Point 5.70
    Sequence mktklwlllvlllsalifsettivvhyhrydgkydgwnlwiwpvepvsqegkayqftgeddfgkvavvk lpmdltkvgiivrlnewqakdvakdrfieikdgkaevwilqgveeifyekpdtspriffaqarsnkvie afltnpvdtkkkelfkvtvdgkeipvsrvekadptdidvtnyvrivlseslkeedlrkdveliiegykp arvimmeilddyyydgelgavyspektifrvwspvskwvkvllfkngedtepyqvvnmeykgngvweav vegdldgvfylyqlenygkirttvdpyskavyanskksavvnlartnpegwendrgpkiegyedaiiye ihiaditglensgvknkglylglteentkgpggvttglshlvelgvthvhilpffdfytgdeldkdfek yynwgydpylfmvpegrystdpknphtrirevkemvkalhkhgigvimdmvfphtygigelsafdqtvp yyfyridktgaylnesgcgnviaserpmmrkfivdtvtywvkeyhidgfrfdqmglidkktmleveral hkidptiilygepwggwgapirfgksdvagthvaafndefrdairgsvfnpsvkgfvmggygketkikr gvvgsinydgkliksfaldpeetinyaachdnhtlwdknylaakadkkkewteeelknaqklagaillt sqgvpflhggqdfcrtknfndnsynapisingfdyerklqfidvfnyhkgliklrkehpafrlknaeei kkhleflpggrrivafmlkdhaggdpwkdivviyngnlekttyklpegkwnvvvnsqkagtevietveg tieldplsayvlyre
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1845

    Name: "pullulane hydrolysis by alpha-1,6 pullulanase and ?"
    Metabolic Subsystem: Starch Metabolism
    Reaction: : h2o + pullulan1200 --> malttr

     
    Name: "starch hydrolysis by alpha-1,4-amylase and alpha-1,6 pullulanase"
    Other genes that carryout this rxn: TM1840
    Metabolic Subsystem: Starch Metabolism
    Reaction: : h2o + starch1200 --> glc-D + malt + malttr

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1845
    generated 12/2008
    Transmembrane protein

    HMM_TM1845

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch