.
The Open Protein Structure Annotation Network
PDB Keyword
.

283707

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283707
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19926,TM1855, 518929 Molecular Weight 48384.22 Da.
    Residues 418 Isoelectric Point 5.07
    Sequence mwkrvllfmlvvlsvfafaevkkivfwtapnpnqetfwkelvekwnaehpdvqiewsvipaagsseeai lnaiaagnapdictnifsgfaaqlaeeldvlvafdeefgeefwklvdarkmrgilegwklnghyyvipi ysnpmlfwwrgdllkelgydkpprtyseiyelakkwvvpkekyviravagrnwwdrwfdfitfyyaasg gkpyiengkavfnneygkavaefiytlfkngwtavdlgqdpfengtilgqlmgpwhlnytkehypevyp hivmtpppvpdnypedkpiytfadtkglvmfehckykkeafefikwvfsnaqndarwieltrmppared lgtnpvfaeymkdpyfakiaeavayavppamitntidvqnamttylmeplmylkatpeealkqavkeinallw
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1855
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch