.
The Open Protein Structure Annotation Network
PDB Keyword
.

283713

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 283713
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS25551,TM1861 Molecular Weight 20003.78 Da.
    Residues 178 Isoelectric Point 9.47
    Sequence mgvsdmnlanffsllraalvipvvwfymegwislsflifvfaaftdyldgffarkknqvtdfgkvfdqv sdkilvistavamldvlplwyvlvvfardtfvnglrilaasrgnvvparwigkaktvsqfvvliaaylf kmgflsnallmffvvlsltvtviswitytidiaritkleg
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1861

    Name: Phosphatidylglycerol synthase (n-C16:0)
    Metabolic Subsystem: Lipid Biosynthesis
    Reaction: : cdpdhdecg + glyc3p --> cmp + h + pgp160
    Classification: EC:2.7.8.5
     

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM1861

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch