.
The Open Protein Structure Annotation Network
PDB Keyword
.

283727

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 283727
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19934,TM1875 Molecular Weight 57378.71 Da.
    Residues 487 Isoelectric Point 5.84
    Sequence mfitgaffdilevgpkkirrcfelvrvrfapsptghlhvggartalfnwmfarkeggkfilriedtdte rssreyeqqileslrwcgldwdegpdiggdfgpyrqserleiyreyaeklvedkrayyvvydkedpske lfttyeypheykekghpvtikfkvlpgktsfedllkgymefdnstledfiimksngfptynfavvvddh lmrishvfrgedhlsntpkqlmiyeafgweapvfmhiplilgsdrtplskrhgatsvehfrregilsra lmnylallgwrvegdeiftieeklqsfdpkdisnkgvifdyqklewvngkhmrridledlkrefiewak yagkeipsvderyfsetlricrekvntlsqlydimypfmnddyeyekdyvekflkreeaervleeakka fkdlnswnmeeiektlrdlsekglaskkvvfqlirgavtgklvtpglfetievlgkertlkrlertlqflkkt
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1875

    Name: Glutamyl-tRNA synthetase (Gln)
    Other genes that carryout this rxn: TM1351
    Metabolic Subsystem: tRNA Metabolism
    Reaction: : atp + glu-L + trnagln --> amp + glutrna(gln) + ppi
    Classification: EC:6.1.1.17
     
    Name: Glutamyl-tRNA synthetase
    Other genes that carryout this rxn: TM1351
    Metabolic Subsystem: tRNA Metabolism
    Reaction: : atp + glu-L + trnaglu --> amp + glutrna + ppi
    Classification: EC:6.1.1.17
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1875
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch