.
The Open Protein Structure Annotation Network
PDB Keyword
.

283730

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283730
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19938,TM1878, _0046.002367_, 89326 Molecular Weight 56486.80 Da.
    Residues 508 Isoelectric Point 4.99
    Sequence mrkflvillallitalllgarltilhvndthghawafdeyrnpgigglatiativeevkrevesqggyv iflhagdlntgvpesdlqdaipdivgfnmmglkamavgnhefdnprevlekqmkfadfpflsanivked gepffnpyivedlgelkiaiigftteeteileplyleglkfenalkvaqkiapelkkqadvvialahld wgepkkedittthqlagvegidvviaghshvlgsdvvdgkiiasageygkyvgrldldiedgkivawhw eaipvnlkvyenekyrylgkpylenryvakaleyfkkvgnekldtvigetkiyldgerehvrskstnla nlivdamrwkvgadiaftngggirasikpgkitvrdiltvlpfgntlyvleltgeqimkvleyaatipe gkgaflqvsgltwkskdgkvvevlvngepldpekkykvvtnnymagggdgyvmfkewdgydtgylmsda vieyiqnvlngkieeyddsqryvre
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1878

    Name: 5'-nucleotidase
    Other genes that carryout this rxn: TM1662
    Metabolic Subsystem: NAD Metabolism
    Reaction: : h2o + nicrnt --> nicrns + pi
    Classification: EC:3.1.3.5
     
    Name: 5'-nucleotidase (dTMP)
    Other genes that carryout this rxn:TM1662
    Metabolic Subsystem: NAD Metabolism
    Reaction: : h2o + nmn --> pi + rnam
    Classification: EC:3.1.3.5
     
    Name: 5'-nucleotidase (AMP)
    Other genes that carryout this rxn: TM1662
    Metabolic Subsystem: Purine Metabolism
    Reaction: : amp + h2o --> adn + pi
    Classification: EC:3.1.3.5
     
    Name: 5'-nucleotidase (XMP)
    Other genes that carryout this rxn:TM1662
    Metabolic Subsystem: Purine Metabolism
    Reaction: : h2o + xmp --> pi + xtsn
    Classification: EC:3.1.3.5
     
    Name: 5'-nucleotidase (IMP)
    Other genes that carryout this rxn: TM1662
    Metabolic Subsystem: Purine Metabolism
    Reaction: : h2o + imp --> ins + pi
    Classification: EC:3.1.3.5
     
    Name: 5'-nucleotidase (GMP)
    Other genes that carryout this rxn:TM1662
    Metabolic Subsystem: Purine Metabolism
    Reaction: : gmp + h2o --> gsn + pi
    Classification: EC:3.1.3.5
     
    Name: 5'-nucleotidase (CMP)
    Other genes that carryout this rxn:TM1662
    Metabolic Subsystem: Pyrimidine Metabolism
    Reaction: : cmp + h2o --> cytd + pi
    Classification: EC:3.1.3.5
     
    Name: 5'-nucleotidase (UMP)
    Other genes that carryout this rxn: TM1662
    Metabolic Subsystem: Pyrimidine Metabolism
    Reaction: : h2o + ump --> pi + uri
    Classification: EC:3.1.3.5
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1878
    generated 12/2008
    Transmembrane protein

    HMM_TM1878

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch