The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 283788
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS88196,CE17806 Molecular Weight 40188.65 Da.
    Residues 362 Isoelectric Point 8.90
    Sequence mhintpvllaiiyflvfapksadawwllsktdtssansgsspilcknvpgltpqqkrmchenpniikyl isglrsalhtceytfqreawnctltlpgvgtsplqiasresayvyaisaagvshslaracskgliddcg cgetpqgsgsvavsqassrsssdfvwagcsdnvkfgntfgrkfvdqydrqhateprsqmnlhnnrvgrr llvnamnkeckchgvsgscvtktcwkvmpkfdefasrlhqkyqlaklvtnndqkltvrsspsagssgrs erfarnmdasskqmrneliyldaspnycaidvkdrecgencpniccgrgwrttreivdepchcqfvwcc evkcktckklvernycl
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch