.
The Open Protein Structure Annotation Network
PDB Keyword
.

283974

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 283974
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS88568,CE00639 Molecular Weight 31448.47 Da.
    Residues 287 Isoelectric Point 8.71
    Sequence lpaltdreyrvresaclalsdllrghdtvemhkmipeyleailrvrddvkesvreaadraadsiskliv rlgsstnsvkaneflavalpavidqgilkstvkansrfclslvldltksagkqlkpyiadlipllmdav senehsvlnylaarsnqqqiealddarasiartspmmtavndllphidsqvlidmtpkiadtlrssvgt strssaaqfvtqlalrapqllvdhtpqcdklfsalipgvrdrnpsirkqfanamsylakftspnqmkkl iktvvadllgs
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch