The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of (np_841403.1) from NITROSOMONAS EUROPAEA at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 2a6c Target Id 358727
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS1402,NP_841403.1, 342266 Molecular Weight 7938.99 Da.
    Residues 71 Isoelectric Point 8.16
    Sequence mkmrsqllivlqehlrnsgltqfkaaellgvtqprvsdlmrgkidlfsleslidmitsiglkveinikd aa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.241
    Matthews' coefficent 2.30 Rfactor 0.182
    Waters 72 Solvent Content 46.01

    Ligand Information



    Protein Summary

    The gene NE1354 from Nitrosomonas europaea encodes the NP_841403.1 protein, a putative XRE-family transcription regulator (based on 52% sequence identity with XRE regulator from Burkholderia ambifaria MEX-5), and a member of DNA-binding domain Helix-Turn-Helix (HTH) superfamily PF01381.  The protein belongs to the class of all alpha proteins and adopts a lambda repressor-like DNA-binding domain fold type SCOP47412.  Prokaryotic XRE-family DNA binding proteins are the xenobiotic response element family of transcriptional regulators.  The structure of similar proteins from other organisms has been solved, including: 3F6W (Dali Zscr=6.5), from Pseudomonas syringae; 2O38 (Dali Zscr=12), from Rhodopseudomonas palustris; and 1Y7Y (Dali Zscr=6), from Aeromonas hydrophila.

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch