The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Solution structure of Asl1650, an acyl carrier protein from Anabaena sp. PCC 7120 with a variant phosphopantetheinylation-site sequence. Protein Sci. 15 1030-1041 2006
    Site JCSG
    PDB Id 2afd Target Id 354432
    Related PDB Ids 2afe 
    Molecular Characteristics
    Source Nostoc sp. pcc 7120
    Alias Ids TPS1916,17135470 Molecular Weight 9830.70 Da.
    Residues 85 Isoelectric Point 4.17
    Sequence mktiqpcsvediqswlidqfaqqldvdpddidmeesfdnydlnsskalillgrlekwlgkelnpvlifn yptiaqlakrlgelyl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2afd
    1. Current understanding of fatty acid biosynthesis and the acyl carrier protein
    D Chan, H Vogel - Biochem. J, 2010 -
    2. Solution structure of Asl1650, an acyl carrier protein from Anabaena sp. PCC 7120 with a variant phosphopantetheinylation_site sequence
    MA Johnson, W Peti, T Herrmann, IA Wilson - Protein , 2006 - Wiley Online Library

    Protein Summary

    The gene 17135470 from Anabaena sp. encodes an acyl carrier protein, a member of phosphopantetheine binding domain proteins PF00550.  The protein belongs to the class of all alpha proteins and reveals an acyl carrier protein-like fold type SCOP47335.  The protein adopts a twisted antiparallel four-helix bundle fold, with a variant phosphopantetheine-attachment motif positioned at the start of the second helix. Structure comparisons with proteins from other organisms suggests a likely physiological function as a discrete peptidyl carrier protein [Ref].  The crystal structure of the protein homologue from Thermotoga maritima is available 1VKU

    Ligand Summary





    1. (No Results)


      Discuss this publication
    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
    No description
    23.95 kB19:20, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch