.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ah6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (10174212) from BACILLUS HALODURANS at 1.60 A resolution. To be published
    Site JCSG
    PDB Id 2ah6 Target Id 354264
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS1327,10174212 Molecular Weight 22419.43 Da.
    Residues 196 Isoelectric Point 7.71
    Sequence mrlytrtgdkgktsviggrlakddtrvvaygttdelnsfvglaitqldentfadirgelfkiqhelfdc ggdlamlkvkedrpykakqeivdfleqridayikeapelerfilpggseaaaslhvcrtiarraeryvv rlqqegeinpivlkylnrlsdyffavarvvnsrlqvpdveyersaivfregkrkedkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.179
    Matthews' coefficent 2.10 Rfactor 0.15
    Waters 549 Solvent Content 40.89

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ah6
    1. A periodic table of coiled-coil protein structures
    E Moutevelis, DN Woolfson - Journal of molecular biology, 2009 - Elsevier
     
    2. Structure of ATP-bound human ATP: cobalamin adenosyltransferase
    HL Schubert, CP Hill - Biochemistry, 2006 - ACS Publications
     
    3. Crystallization and preliminary X-ray crystallographic studies of a PduO-type ATP: cob (I) alamin adenosyltransferase from Bacillus cereus
    AK Park, JH Moon, SH Lee, YM Chi - Acta Crystallographica Section , 2008 - scripts.iucr.org
     

    Protein Summary

    The gene BH1595 from Bacillus halodurans encodes the NP_242461 protein, a putative ethanolamine utilization cobalamin adenosyltransferase (70% sequence identity) PF01923 EC:2.5.1.17 COG4812 (alternative names: Cob(I)yrinic acid a,c-diamide adenosyltransferase, aquacobalamin adenosyltransferase).  

    The 2ah6 structure belongs to the class of all alpha proteins and reveals ferritin-like fold SCOP46456 inside the cobalamin adenosyltransferase-like (super)family. Multiple structures of the enzyme homologues from different organisms have been solved: 2r6x Lactobacillus Reuteri (48% sequence identity; Z=23); 1rty, Bacillus subtilis (65% sequence identity; Z=27); 1nog, Thermoplasma acidophilum (41% sequence identity; Z=25).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch