.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b33

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Protein synthesis inhibitor, putative (tm0215) from THERMOTOGA MARITIMA at 2.30 A resolution. To be published
    Site JCSG
    PDB Id 2b33 Target Id 282095
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1192,TM0215, 289480 Molecular Weight 14267.64 Da.
    Residues 128 Isoelectric Point 5.12
    Sequence mkrfvetdkapkaigpysqavvvgnmmfvsgqipidpetgelvqgtieektervlenlkaileaggfsl kdvvkvtvfttsmdyfqrvnevysryfgdhrparsfvavaqlprnveieieaiavkege
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.261
    Matthews' coefficent 1.98 Rfactor 0.199
    Waters 80 Solvent Content 37.52

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2b33
    1. The crystal structure of Escherichia coli TdcF, a member of the highly conserved YjgF/YER057c/UK114 family
    J Burman, C Stevenson, RG Sawers - BMC structural , 2007 - biomedcentral.com
     

    Protein Summary

    The TM0125 gene from Thermotoga maritima codes for the NP_228030 protein, from the endoribonuclease L-PSP group PF01042, EC:3.1.26.12). 

    SCOP classifies 2b33 in the alpha+beta class, YjgF-like superfamily, YjgF/L-PSP family. DALI top hits are with the PH0854 protein 2dyy (Z=25), the protein ST0811 1x25 (Z=24), the YABJ protein 1qd9 (Z=24) and the translation initiation inhibitor YJGF 1xrg (Z=24).

    The enzyme acts on only the single-stranded mRNA and inhibits protein synthesis by cleavage of mRNA.  The modification of mRNA template induces disaggregation of the reticulocyte polysomes into 80S ribosomes, even in the presence of cycloheximide [Ref].  This endoribonuclease may also be involved in the regulation of purine biosynthesis [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch