.
The Open Protein Structure Annotation Network
PDB Keyword
.

2etd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of LEMA protein (tm0961) from THERMOTOGA MARITIMA at 2.28 A resolution. To be published
    Site JCSG
    PDB Id 2etd Target Id 358514
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1396,TM0961, PF04011 Molecular Weight 17917.38 Da.
    Residues 159 Isoelectric Point 5.41
    Sequence lvsleqevqekysqiqnqlqrradlipnlvetvkgyaahekeileeianarakligaktpqesaqadae lssalsrllaiaenypnlkadanfrqlmdelagtenriavarrdyneavkkyntaikkfpgvifakmfg feekqyfeakpgaeevpevkf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.28 Rfree 0.27
    Matthews' coefficent 2.29 Rfactor 0.216
    Waters 62 Solvent Content 46.39

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2etd
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Automatic procedure for using models of proteins in molecular replacement
    D Raimondo, A Giorgetti, S Bosi - PROTEINS: Structure, , 2007 - Wiley Online Library
     
    3. Structure and ligand binding of the soluble domain of a Thermotoga maritima membrane protein of unknown function TM1634
    CJ McCleverty, L Columbus, A Kreusch - Protein , 2008 - Wiley Online Library
     

    Protein Summary

    The gene TM0961 from Thermotoga maritima encodes a predicted transmembrane protein (NP_228769) from the LemA family PF04011.

    SCOP classifies 2etd in the all alpha class, bromodomain-like fold, LemA-like (super)family. DALI weak hits are with the huntingtin interacting protein-12 PDB:1r0d (Z=9), pectin methylesterase inhibitor PDB:1x90 (Z=9) and the uncharacterized XCC0516 protein PDB:2gsc (Z=9).

    The protein is highly conserved among different bacterial species.  The LemA protein family performs regulatory functions. In the context of bacterial intracellular pathogens, they modulate guest-host relationships.  For example, the LemA gene is required for pathogenicity of Pseudomonas syringae on bean [Ref].  The LemA proteins contain a transmembrane domain and an N-terminal extracellular domain.  The exposed N-terminal domain of the LemA protein is the major antigen for recognition by the immune system of the infected multicellular organism [Ref].    

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch