.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f22

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of BH3987 from Bacillus halodurans at 1.42 A resolution. To be published
    Site JCSG
    PDB Id 2f22 Target Id 359078
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS1414,10176612, PF05163, 291253 Molecular Weight 16576.29 Da.
    Residues 143 Isoelectric Point 5.94
    Sequence mdtngvlyaanmtnalakeipeskwdiqlipelgtlrklfihivrvrdvyrdglktgsikfpgrlasde hrlldelersmeelvfefkqttfnsikmgenylsimellgtviqhegihqgqyyvalkqsginlpkqwv qdwhm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.42 Rfree 0.182
    Matthews' coefficent 2.27 Rfactor 0.157
    Waters 421 Solvent Content 45.77

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2f22
    1. Structural classification of proteins and structural genomics: new insights into protein folding and evolution
    A Andreeva, AG Murzin - Acta Crystallographica Section F: Structural , 2010 - scripts.iucr.org
     
    2. The structure of DinB from Geobacillus stearothermophilus: a representative of a unique four-helix-bundle superfamily
    DR Cooper, K Grelewska, CY Kim - Section F: Structural , 2010 - scripts.iucr.org
     
    3. Molecular modeling and identification of substrate binding site of orphan human cytochrome P450 4F22
    S Kumar - Bioinformation, 2011 - ncbi.nlm.nih.gov
     
    4. Overexpression of human antiquitin in E. coli: Enzymatic characterization of twelve ALDH7A1 missense mutations associated with pyridoxine-
    MB Coulter-Mackie, A Li, Q Lian, E Struys - Molecular Genetics and , 2012 - Elsevier
     
    5. Structure and mechanism of peptide-induced membrane pores
    S Qian - 2009 - books.google.com
     

    Protein Summary

    The gene BH3987 from Bacillus halodurans encodes a protein belonging to the family of DNA damage-inducable (DinB) proteins PFAM:PF05163. The protein belongs to the class of all alpha proteins and reveals DinB/YfiT-like metalloenzymes fold type SCOP109853 SUNID:140603. The crystal structures of the homologue proteins from the same organism PDB:2RD9 and from Bacillus subtilis PDB:1RXQ, have been solved. It is plausible that the enzyme might function as a metal-dependent hydrolase (GO:0016787).

    Ligand Summary

    The metal site is modeled as nickel, though it could be zinc. A metal scan was inconclusive.

    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch