.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f4l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Acetamidase, putative (tm0119) from THERMOTOGA MARITIMA at 2.50 A resolution. To be published
    Site JCSG
    PDB Id 2f4l Target Id 282000
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1183,TM0119, PF03069, 89973, 90124 Molecular Weight 31194.41 Da.
    Residues 285 Isoelectric Point 5.19
    Sequence mkvvpaqrcvysfsanmapveevypgeqvvfetldalggsydkidfskvnpatgpvfvngvkpgdtlkv rikrielprrgmivtgkgfgvlgdevegfhtkeleiekwavlfdgvripihpmvgvigvapqegeyptg tahrhggnmdtkeitenvtvhlpvfqegallalgdvhatmgdgevcvsacevpakvvveidvskeeikw pvvetndayyiivslpdieealkevtretvwfiqrrktipftdaymlaslsvdvgisqlvnpaktakar ipkyiftgv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.242
    Matthews' coefficent 2.44 Rfactor 0.192
    Waters 163 Solvent Content 54.16

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2f4l
    1. Zinc through the three domains of life
    C Andreini, L Banci, I Bertini - Journal of proteome , 2006 - ACS Publications
     
    2. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    3. On the combination of molecular replacement and single-wavelength anomalous diffraction phasing for automated structure determination
    S Panjikar, V Parthasarathy, VS Lamzin - Section D: Biological , 2009 - scripts.iucr.org
     
    4. Re-Annotation of Two Hyperthermophilic Archaea Pyrococcus abyssi GE5 and Pyrococcus furiosus DSM 3638
    J Gao, J Wang - Current microbiology, 2012 - Springer
     
    5. Crystal Structure Analysis of a Recombinant Predicted Acetamidase/Formamidase from the Thermophile Thermoanaerobacter tengcongensis
    M Qian, Q Huang, G Wu, L Lai, Y Tang, J Pei - The Protein , 2012 - Springer
     

    Protein Summary

    TM0119 gene from Thermotoga maritima encodes the protein NP_227935, a putative acetamidase (similar to proteins from COG2421). TM0119 shows a tandem repetition (1-140; 140-280) of the PF03069 group sequence that contains amidohydrolases of formamide (EC:3.5.1.49) and acetamide. Its neighboring gene, TM0120, is annotated as putative oxidoreductase.


    SCOP classifies 2f4l in the all beta class, acetamidase/formamidase-like (super)family. 2f4l top Dali hits are with PDB:2ii1 (Z-scr=41), and PDB:3b9t (Z-scr=34). The N-terminal domain is a jelly-roll made of two greek-key motifs and is most commonly seen in viral capsid proteins. It contains extensive insertions to the jelly-roll core. It is difficult to determine if the insert region (76-120) should be classified as a separate domain. The C-terminal is a small domain with structural similarity to the SCOP fold: probable bacterial effector-binding domain (link).

    An industrially attractive L-specific amidase belongs to the same protein family ([Ref]) indicating that TM0119 may have substrate specificity for the L-enantiomers.

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch