The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (tm1010) from THERMOTOGA MARITIMA at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 2f4p Target Id 282877
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1252,TM1010,, 84788, 90095 Molecular Weight 15051.23 Da.
    Residues 135 Isoelectric Point 5.76
    Sequence mvddifergskgssdfftgnvwvkmlvtdengvfntqvydvvfepgarthwhshpggqilivtrgkgfy qergkparilkkgdvveippnvvhwhgaapdeelvhigistqvhlgpaewlgsvteeeyrkategk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.216
    Matthews' coefficent 2.07 Rfactor 0.16
    Waters 506 Solvent Content 40.23

    Ligand Information


    Google Scholar output for 2f4p
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
    2. Crystallization of a novel metal-containing cupin from Acidobacterium sp. and preliminary diffraction data analysis
    A Lyskowski, K Steiner, I Hajnal - Section F: Structural , 2012 - scripts.iucr.org

    Protein Summary

    The TM1010 gene from Thermotoga maritima encodes the NP_228816 protein, a member of the Cupin2 superfamily  PF07883 COG3450.  This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel). This family also includes germins and plant storage proteins [Ref] . Analysis of TM1010 genome context predicts a functional link (score 0.86) TM1009, an oxidoreductase from the aldo/keto reductase family.

    SCOP classifies 2f4p in the double stranded beta helix fold, RmlC-like cupins superfamily, TM1287-like family. A DALI structural similarity search provides hits with the REMF protein PDB:3ht2 (Z=14), a putative oxalate decarboxylase PDB:1o4t (Z=14), and the TM1459 protein PDB:1vj2 (Z=14).

    Ligand Summary





    1. (No Results)


      Discuss this publication
    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch