.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fno

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Comparative structural analysis of a novel glutathioneS-transferase (ATU5508) from Agrobacterium tumefaciens at 2.0 A resolution. Proteins 65 527-537 2006
    Site JCSG
    PDB Id 2fno Target Id 354428
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS1331,15162326 Molecular Weight 26035.41 Da.
    Residues 236 Isoelectric Point 4.83
    Sequence medgmntfdlyywpvpfrgqlirgilahcgcswdehdvdaieglmdcgaekqpvafmgppvlidrernf aisqmpaiaiylgerldilpatvegrtlsakivndandvldeltlnggremwtpekwqefvprlqkwir ifadtgarnglsaasgfmlgtekigvadivtailwttvadrfpaikgiiedtspiiwglsrrvvatapl aalnsksfeeygnaycggeiekslrkvas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.219
    Matthews' coefficent 2.67 Rfactor 0.181
    Waters 395 Solvent Content 53.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fno
    1. Comparative structural analysis of a novel glutathioneS_transferase (ATU5508) from Agrobacterium tumefaciens at 2.0 resolution
    M Kosloff, GW Han, S Krishna - PROTEINS: , 2006 - Wiley Online Library
     
    2. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     
    3. The role of a conserved interdomain interaction in Escherichia coli Glutaredoxin-2
    N Parbhoo - 2010 - wiredspace.wits.ac.za
     

    Protein Summary

    The Atu5508 gene from A. tumefaciens encodes the NP_396442 protein, a putative glutathione S-transferase (GST) (PF02798, PF00043). The N-terminal domain of proteins from this family has a thioredoxin fold and is involved in glutathione binding. It is more  conserved than the helical C-terminal domain, forming GST specific fold of a closed 4 helical bundle forming a righ-handed superhelix.

    SCOP classifies 2fno N-terminal domain (1-88) inside the alpha/beta class, thioredoxin-like superfamily, GST N-terminal domain family; and the C-terminal region (88-236) in the all alpha class, GST C-terminal domain like (super)family. 2fno structure is strongly similar (DALI Z-scores) to other glutathione S-transferases, like: PDB:2oa7 (Z=22), PDB:4pgt (Z=21), PDB:5gss (Z=21), PDB:1tu7 (Z=22), despite relatively low sequence identity (~15-20%).

    Analysis of the crystallographic packing of 2fno using the PQS server {Henrick, 1998 #73} indicates that a dimer is the biologically relevant form.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch