.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ftr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of (10172812) from BACILLUS HALODURANS at 1.40 A resolution. To be published
    Site JCSG
    PDB Id 2ftr Target Id 359048
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS1411,10172812, PF07110, 87289 Molecular Weight 12332.63 Da.
    Residues 107 Isoelectric Point 5.20
    Sequence mkgenmmvklialyeqpedkqafdehyfnthapltrkipglrdmkvtrivgspmgeskfylmcemyydd heslqqamrtdegkasgkdamkfagklltlmigeemde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.40 Rfree 0.174
    Matthews' coefficent 2.04 Rfactor 0.148
    Waters 281 Solvent Content 39.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ftr
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     

    Protein Summary

    Gene BH0200 from Bacillus halodurans encodes the protein NP_241066, the first structural representative of the EthD family (PF07110).  EthD is thought to be involved in the degradation of ethyl tert-butyl ether (ETBE). BH0200 genome context indicates a functional linkage (score 0.88) with yitW (BH0199), the ring oxidation complex protein 3 in the phenylacetic acid catabolism pathway, and the phaA (BH0201) and phaB (BH0202) genes, both coding for enoyl-CoA hydratases.

     

    SCOP classifies 2ftr in the alpha+beta class, ferredoxin-like fold, dimeric alpha+beta barrel superfamily, EthD-like family. Dali top hits (Z_scr=11) is with other EthD-like structures such as PDB:3bf4, PDB:3bde, PDB:3bn7 and with the thermostable plant protein PDB:1tr0.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch