.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ghs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Calcium-binding protein, regucalcin (15155668) from AGROBACTERIUM TUMEFACIENS at 1.55 A resolution. To be published
    Site JCSG
    PDB Id 2ghs Target Id 355654
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS1347,15155668 Molecular Weight 33985.52 Da.
    Residues 314 Isoelectric Point 5.65
    Sequence mnaplshsrpmmqpsedkslatvfpfagrvldetpmllgegptfdpasgtawwfnilerelhelhlasg rktvhalpfmgsalakisdskqliasddglflrdtatgvltlhaelesdlpgnrsndgrmhpsgalwig tmgrkaetgagsiyhvakgkvtklfadisipnsicfspdgttgyfvdtkvnrlmrvpldartglptgka evfidstgikggmdgsvcdaeghiwnarwgegavdrydtdgnhiaryevpgkqttcpafigpdasrllv tsarehldddaitanpqhgltfelgievkgrfeplyrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.176
    Matthews' coefficent 1.92 Rfactor 0.137
    Waters 383 Solvent Content 35.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ghs
    1. Crystal structure of human senescence marker protein 30: insights linking structural, enzymatic, and physiological functions
    S Chakraborti, BJ Bahnson - Biochemistry, 2010 - ACS Publications
     
    2. In search of a catalytic bioscavenger for the prophylaxis of nerve agent toxicity
    RC diTargiani, L Chandrasekaran, T Belinskaya - Chemico-biological , 2010 - Elsevier
     
    3. Computational enzyme design
    A Zanghellini - 2009 - books.google.com
     

    Protein Summary

    Gene AGR_C_1268 from Agrobacterium tumefaciens encodes a calcium-binding protein, regucalcin (NP_353727), that belongs to the SMP-30/gluconolactonase/LRE-like family (COG3386, Pfam08450), which is a part of a larger beta propeller clan that includes over 16 PFAM families with very diverse functions. Its genome context analysis indicates a possible functional link (score 0.9) with the gene Atu0703, a keto-hydroxyglutarate-aldolase. 

    2ghs structure is from the all beta class, showing a 6-bladed beta-propeller fold, consisting of six 4-stranded beta-sheet motifs, forming a beta-meander, inside the Ca-dependent phosphotriesterase superfamily, SGL-like family (SCOP sunid:50938). Most similar structures, according to DALI, include the human regucalcin 3g4e (Z-scr=42), diisopropyl fluorophosphatase from Loligo vulgaris (2gvu, Z=30; and 1e1a, Z=30) and 35kDa drug responsive protein from Staphylococcus aureus  (2dg0, Z=29).

    Homologs of regucalcin are strongly conserved in all vertebrate species and in humans, and their expression is highly correlated with aging. Thus the human homolog is also known as "senescence marker protein".

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch