The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Glutamyl-tRNA(Gln) amidotransferase subunit A (tm1272) from THERMOTOGA MARITIMA at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 2gi3 Target Id 283137
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1274,TM1272 Molecular Weight 52525.66 Da.
    Residues 475 Isoelectric Point 7.59
    Sequence midldfrkltieeclklseeereklpqlsletikrldphvkafisvrenvsvekkgkfwgipvaikdni ltlgmrttcasrilenyesvfdatvvkkmkeagfvvvgkanldefamgsstersaffptrnpwdlervp ggssggsaaavsagmvvaalgsdtggsvrqpaslcgvvgykptyglvsryglvafassldqigpitktv rdaailmeiisgrdendattvnrkvdflseieegvsgmkfavpeeiyehdieegvserfeealkllerl gakvervkiphikysvatyyviapaeassnlarfdgvkyglrikekglremymktrnvgfgeevrrrim igtftlsaayyeayfnkamkvrrkisdelnevlsqydailtptspvtafkigeikdpltyylmdiftip anlaglpaisvpfgfsnnlpvgvqvigrrfadgkvfriaraieknspynengmfplpevka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.201
    Matthews' coefficent 2.83 Rfactor 0.175
    Waters 339 Solvent Content 56.20


    Reactions found in Metabolic Reconstruction for TM1272

    Name: aspartyl-tRNA(Asn) amidotransferase
    Other genes that carryout this rxn:TM1273 TM0252
    Metabolic Subsystem: tRNA Metabolism
    Reaction: : asptrna(asn) + atp + gln-L + h2o --> adp + asntrna + glu-L + h + pi
    Name: glutamyl-tRNA(Gln) amidotransferase
    Other genes that carryout this rxn:TM1273 TM0252
    Metabolic Subsystem: tRNA Metabolism
    Reaction: : atp + gln-L + glutrna(gln) + h2o --> adp + glntrna + glu-L + h + pi

    Ligand Information


    Google Scholar output for 2gi3
    1. On the combination of molecular replacement and single-wavelength anomalous diffraction phasing for automated structure determination
    S Panjikar, V Parthasarathy, VS Lamzin - Section D: Biological , 2009 - scripts.iucr.org
    2. Insights into tRNA-dependent amidotransferase evolution and catalysis from the structure of the Aquifex aeolicus enzyme
    J Wu, W Bu, K Sheppard, M Kitabatake - Journal of molecular , 2009 - Elsevier
    3. Structure and characterization of amidase from Rhodococcus sp. N-771: Insight into the molecular mechanism of substrate recognition
    A Ohtaki, K Murata, Y Sato, K Noguchi - et Biophysica Acta (BBA , 2010 - Elsevier
    4. Structural Relationship between the Active Sites of _-Lactam-Recognizing and Amidase Signature Enzymes: Convergent Evolution?
    RF Pratt, MJ McLeish - Biochemistry, 2010 - ACS Publications

    Protein Summary

    The gene TM1272 from Thermotoga maritima encodes glutamyl- and/or aspartyl-tRNA  amidotransferase (AdTase) subunit A  [Ref] E.C., a member of  amidases family PF01425 COG0154.  The enzyme is heterodimeric/possesses two clearly defined structural domains. They are widespread, being found in both prokaryotes and eukaryotes.  These enzymes posses a unique, highly conserved Ser-Ser-Lys catalytic triad used for amide hydrolysis, although the catalytic mechanism for acyl-enzyme intermediate formation can differ between enzymes [Ref].  Two different types of AdTase are currently known. One is a heterotrimeric enzyme, a typical form in Gram-positive eubacteria. In contrast, AdTase from archaebacteria consists of two different subunits/domains [Ref], as in the given case.

    Ligand Summary





    1. (No Results)


      Discuss this publication
    2. (No Results)


      Discuss this publication
    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch