.
The Open Protein Structure Annotation Network
PDB Keyword
.

2grj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) (tm1387) from THERMOTOGA MARITIMA at 2.60 A resolution. To be published
    Site JCSG
    PDB Id 2grj Target Id 283248
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1282,TM1387, BIG_267, 84816 Molecular Weight 20329.93 Da.
    Residues 180 Isoelectric Point 9.00
    Sequence mvigvtgkigtgkstvceilknkygahvvnvdrighevleevkeklvelfggsvledgkvnrkklagiv fesrenlkklellvhplmkkrvqeiinktsglivieaallkrmgldqlcdhvitvvasretilkrnrea drrlkfqedivpqgivvannstledlekkveevmklvwekre
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.60 Rfree 0.245
    Matthews' coefficent 2.10 Rfactor 0.191
    Waters 67 Solvent Content 42.20

    Pathway

    Reactions found in Metabolic Reconstruction for TM1387

    Name: dephospho-CoA kinase
    Metabolic Subsystem: Pantothenate and CoA Metabolism
    Reaction: : atp + dpcoa --> adp + coa + h
    Classification: EC:2.7.1.24
     

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2grj
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Structural bioinformatics analysis of enzymes involved in the biosynthesis pathway of the hypermodified nucleoside ms2io6A37 in tRNA
    KH Kaminska, U Baraniak, M Boniecki - Proteins: Structure, , 2008 - Wiley Online Library
     
    3. Sequence and structure continuity of evolutionary importance improves protein functional site discovery and annotation
    AD Wilkins, R Lua, S Erdin, RM Ward - Protein , 2010 - Wiley Online Library
     
    4. Biocatalytic Production of Coenzyme A Analogues
    E Strauss, M de Villiers, I Rootman - ChemCatChem, 2010 - Wiley Online Library
     

    Protein Summary

    The gene TM1387 from Thermotoga maritima encodes dephospho-CoA kinase PF01121 COG0237.  Dephospho-CoA kinase (DPCK) catalyzes the phosphorylation of dephosphocoenzyme A (dCoA) to yield CoA, which is the final step in the CoA biosynthesis.  The structure of its homologue from Aquifex Aeolicus has been previously solved 2IF2.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch