.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gvh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Acyl-CoA hydrolase (15159470) from AGROBACTERIUM TUMEFACIENS at 2.65 A resolution. To be published
    Site JCSG
    PDB Id 2gvh Target Id 354259
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS1326,15159470 Molecular Weight 29991.55 Da.
    Residues 276 Isoelectric Point 5.82
    Sequence mteiatiekpaqhgattrlidivfpgdtnhhgtlfggtglalmdrvafiaatrfgrtpfvtasceridf rqparighiveftarpvkagrrsltvevemvaetiigrqqhtctrgifhmvaipegedaasyvlpellt eetpdpsdavtmveivfpdqansagrmfggeaiaymtkaafvaasrycgklvvlasseridfaraieig eiveaqahvervgrssmsiqtklwsenlltgerhitatghftmvavdkdhrpatirdpaeafslekgga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.50 Rfree 0.244
    Matthews' coefficent 3.13 Rfactor 0.226
    Waters Solvent Content 60.75

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gvh
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Structure of YciA from Haemophilus influenzae (HI0827), a Hexameric Broad Specificity Acyl-Coenzyme A Thioesterase,
    MA Willis, Z Zhuang, F Song, A Howard - Biochemistry, 2008 - ACS Publications
     
    3. Analysis of proteins with the'hot dog'fold: Prediction of function and identification of catalytic residues of hypothetical proteins
    LS Pidugu, K Maity, K Ramaswamy - BMC structural , 2009 - biomedcentral.com
     
    4. Medaka: a promising model animal for comparative population genomics
    Y Matsumoto, H Oota, Y Asaoka, H Nishina - BMC research , 2009 - biomedcentral.com
     
    5. Structure and function of a Campylobacter jejuni thioesterase Cj0915, a hexameric hot dog fold enzyme
    T Yokoyama, KJ Choi, AM Bosch, HJ Yeo - Biochimica et Biophysica Acta ( , 2009 - Elsevier
     
    6. Alternative to homo-oligomerisation: the creation of local symmetry in proteins by internal amplification
    AL Abraham, J Pothier, EPC Rocha - Journal of molecular biology, 2009 - Elsevier
     
    7. Beta-Strand Interfaces of Non-Dimeric Protein Oligomers Are Characterized by Scattered Charged Residue Patterns
    G Feverati, M Achoch, J Zrimi, L Vuillon, C Lesieur - PloS one, 2012 - dx.plos.org
     

    Protein Summary

    The gene 15159470 from Agrobacterium tumefaciens encodes Acyl-CoA hydrolase, a member of thioesterase superfamily PF03061 EC:3.1.2.20 COG1607.  The enzyme deacylates long-chain fatty acids by hydrolyzing acyl-CoA thioesters to free fatty acids and CoA-SH.  The archeal and eukaryotic members of this family have two tandem copies of the conserved hot dog fold SCOP54638, while most bacterial members have only one copy.  The structure of homologous enzyme from Bacillus halodurans is available 1VPM.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch