.
The Open Protein Structure Annotation Network
PDB Keyword
.

2h56

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of DNA-3-methyladenine glycosidase (10174367) from Bacillus halodurans at 2.55 A resolution. To be published
    Site JCSG
    PDB Id 2h56 Target Id 358704
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS1401,10174367, 382553 Molecular Weight 24688.93 Da.
    Residues 221 Isoelectric Point 5.62
    Sequence mryfstdspevktivaqdsrlfqfieiagevqlptkpnpfqslvssiveqqlsikaasaiygrveqlvg galekpeqlyrvsdealrqagvskrkieyirhvcehvesgrldftelegaeattviekltaikgigqwt aemfmmfslgrldvlsvgdvglqrgakwlygngegdgkklliyhgkawapyetvaclylwkaagtfaee yrsleellhhgnqc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.55 Rfree 0.246
    Matthews' coefficent 3.20 Rfactor 0.196
    Waters 40 Solvent Content 61.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2h56
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Molecular mechanisms of the whole DNA repair system: a comparison of bacterial and eukaryotic systems
    R Morita, S Nakane, A Shimada, M Inoue, H Iino - Journal of nucleic , 2010 - hindawi.com
     
    3. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    4. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     
    5. Structural Studies of Alkylpurine DNA Glycosylases
    EH Rubinson, S Adhikary - ACS Symposium Series , 2010 - structbio.vanderbilt.edu
     
    6. Structure-function studies of an unusual 3-methyladenine DNA glycosylase II (AlkA) from Deinococcus radiodurans
    E Moe, DR Hall, I Leiros, VT Monsen - Section D: Biological , 2012 - scripts.iucr.org
     
    7. Analysis of substrate specificity of Schizosaccharomyces pombe Mag1 alkylpurine DNA glycosylase
    S Adhikary, BF Eichman - EMBO reports, 2011 - nature.com
     
    8. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     

    Protein Summary

    The gene 10174367 from Bacillus halodurans encodes 3-methyladenine-DNA glycosylase II EC:3.2.2.21 (alternative names: DNA-3-methyladenine glycosylase II, DNA glycosidase II), a member of HhH-GPD superfamily base excision DNA repair proteins PF00730.  The protein belongs to the class of all-alpha proteins and reveals DNA-glycosylase fold type SCOP48149.  Base-excision DNA repair proteins target alkylation damage from duplex and single stranded DNA [Ref].  The structure of the enzyme homologue from E.coli has been solved 1MPG

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch