.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hdo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from Lactobacillus plantarum at 1.50 A resolution. To be published
    Site JCSG
    PDB Id 2hdo Target Id 366929
    Molecular Characteristics
    Source Lactobacillus plantarum wcfs1
    Alias Ids TPS1491,NP_784602.1, 90342 Molecular Weight 23241.16 Da.
    Residues 208 Isoelectric Point 4.71
    Sequence mtyqalmfdidgtltnsqpayttvmrevlatygkpfspaqaqktfpmaaeqamtelgiaasefdhfqaq yedvmashydqielypgitslfeqlpselrlgivtsqrrnelesgmrsypfmmrmavtisaddtpkrkp dplplltalekvnvapqnalfigdsvsdeqtaqaanvdfglavwgmdpnadhqkvahrfqkpldilelfk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.209
    Matthews' coefficent 2.00 Rfactor 0.176
    Waters 212 Solvent Content 43.09

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hdo
    1. Assessment of predictions submitted for the CASP7 function prediction category
    G Lopez, A Rojas, M Tress - : Structure, Function, and , 2007 - Wiley Online Library
     
    2. Research Non-homologous isofunctional enzymes: A systematic analysis of alternative solutions in enzyme evolution
    MV Omelchenko, MY Galperin, YI Wolf, EV Koonin - 2010 - biomedcentral.com
     
    3. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    4. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    5. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    6. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     
    7. Structural biology of the hepatitis C virus proteins
    BM Weiser, TL Tellinghuisen - Drug Discovery Today: Technologies, 2011 - Elsevier
     

    Protein Summary

    The gene NP_784602.1 from Lactobacillus plantarum encodes a putative phosphoglycolate phosphatase EC:3.1.3.18.  The enzyme belongs to the class of alpha and beta (a+b) proteins and adopts a  HAD-like fold type SCOP56784. The enzyme catalyzes the following reaction: 2-phosphoglycolate + H(2)O <=> glycolate + phosphate.  The enzyme participates in glyoxylate and dicarboxylate metabolism.  The structures of several enzyme homologues from other organisms have been solved: 2YY6Aquifex aeolicus; 1WR8,  Pyrococcus horikoshii

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch