.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hh6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of BH3980 (10176605) from BACILLUS HALODURANS at 2.04 A resolution. To be published
    Site JCSG
    PDB Id 2hh6 Target Id 361188
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS1465,10176605, PF06304, 90565 Molecular Weight 12901.04 Da.
    Residues 112 Isoelectric Point 6.13
    Sequence msfiekmigslndkrewkamearakalpkeyhhaykaiqkymwtsggptdwqdtkrifggildlfeega aegkkvtdltgedvaafcdelmkdtktwmdkyrtklndsigrd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.04 Rfree 0.238
    Matthews' coefficent 5.26 Rfactor 0.224
    Waters 78 Solvent Content 76.43

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hh6
    1. Macromolecular modeling with rosetta
    R Das, D Baker - Annu. Rev. Biochem., 2008 - annualreviews.org
     
    2. High-resolution structure prediction and the crystallographic phase problem
    B Qian, S Raman, R Das, P Bradley, AJ McCoy - Nature, 2007 - nature.com
     
    3. Practically useful: what the Rosetta protein modeling suite can do for you
    KW Kaufmann, GH Lemmon, SL DeLuca - Biochemistry, 2010 - ACS Publications
     
    4. Protein structure prediction and model quality assessment
    A Kryshtafovych, K Fidelis - Drug discovery today, 2009 - Elsevier
     
    5. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    6. On the combination of molecular replacement and single-wavelength anomalous diffraction phasing for automated structure determination
    S Panjikar, V Parthasarathy, VS Lamzin - Section D: Biological , 2009 - scripts.iucr.org
     
    7. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    8. Alternate states of proteins revealed by detailed energy landscape mapping
    MD Tyka, DA Keedy, I Andr, F DiMaio, Y Song - Journal of molecular , 2011 - Elsevier
     
    9. A coarse-grained Langevin molecular dynamics approach to de novo protein structure prediction
    TN Sasaki, H Cetin, M Sasai - Biochemical and biophysical research , 2008 - Elsevier
     
    10. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    11. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    12. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary

    The gene BH3980 from Bacillus halodurans probably encodes the NP_244848 protein, a transcriptional regulator from the DUF1048 group (PF06304), homologous to PadR 3HHH (sequence identity with YP_003354695 is 44%) and LmrR 3F8B families of transcription regulators.  

    SCOP classifies 2hh6 inside the left-handed superhelix fold, BH3980-like (super)family. DALI only provides weak hits (Z=10) with the BH3976 protein 2o4t and 2o3l. The structure comparison searches using 2hh6 as query demonstrates significant similarities to these transcription regulators, although several structural features differ. PadR acts as a repressor of padA gene expression in the phenolic acid stress response, which is important in plant-soil ecosystems.  LmrR is PadR-related transcriptional repressor that regulates the production of LmrCD, a major multidrug ABC transporter in Lactococcus lactis. Transcriptional regulation is presumed to follow a drug-sensitive induction mechanism involving the direct binding of transporter ligands to LmrR.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch