.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hkv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of conserved hypothetical protein RBL00553 (ZP_00537729.1) from EXIGUOBACTERIUM SP. 255-15 at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 2hkv Target Id 361006
    Molecular Characteristics
    Source Exiguobacterium sibiricum 255-15
    Alias Ids TPS1460,YP_001813732.1, PF05163, 90217 Molecular Weight 17154.48 Da.
    Residues 148 Isoelectric Point 4.79
    Sequence mtdwqqaldrhvgvgvrttrdlirliqpedwdkrpisgkrsvyevavhlavlleadlriatgatadema qfyavpvlpeqlvdrldqswqyyqdrlmadfstettywgvtdsttgwlleaavhlyhhrsqlldylnll gydikldlfe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.227
    Matthews' coefficent 21.40 Rfactor 0.181
    Waters 65 Solvent Content 42.07

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hkv
    1. Assessment of predictions submitted for the CASP7 function prediction category
    G Lopez, A Rojas, M Tress - : Structure, Function, and , 2007 - Wiley Online Library
     
    2. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    3. Estimating quality of template_based protein models by alignment stability
    H Chen, D Kihara - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    4. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    5. The structure of DinB from Geobacillus stearothermophilus: a representative of a unique four-helix-bundle superfamily
    DR Cooper, K Grelewska, CY Kim - Section F: Structural , 2010 - scripts.iucr.org
     
    6. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    7. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary

    The Exig_1237 gene from Exiguobacterium sp. 255-15 encodes the YP_001813732 amino acid sequence that belongs to the DinB superfamily (PF05163).

    SCOP classifies 2hkv inside the DinB/YfiT-like putative metalloenzymes superfamily.

    Dali top hits for 2hkv are with 2p1a (Z-scr=18) and the YfiT-like protein 1rxq [Ref] (Z-scr=14).

    2hkv contains the characteristic triad of histidines (H48, H123 and H127) that coordinate the nickel ion.  In particular the two histidines that are part of the C-terminal alpha helix contain the HXYHHR sequence motif that is also found in the 2p1a structure.
     

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch