.
The Open Protein Structure Annotation Network
PDB Keyword
.

2iab

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (NP_828636.1) from STREPTOMYCES AVERMITILIS at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 2iab Target Id 367003
    Molecular Characteristics
    Source Streptomyces avermitilis ma-4680
    Alias Ids TPS1496,NP_828636.1, 90893 Molecular Weight 16873.05 Da.
    Residues 154 Isoelectric Point 4.94
    Sequence mttppartakqriqdtlnrleldvdawvstagadggapylvplsylwdgetflvatpaasptgrnlset grvrlgigptrdlvlvegtalplepaglpdgvgdtfaektgfdprrlttsylyfrisprrvqawreane lsgrelmrdgewlvtd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.23
    Matthews' coefficent 2.35 Rfactor 0.178
    Waters 234 Solvent Content 47.28

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2iab
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    3. The structure of a Xanthomonas general stress protein involved in citrus canker reveals its flavin-binding property
    E Hilario, Y Li, D Niks, L Fan - Acta Crystallographica Section D: , 2012 - scripts.iucr.org
     
    4. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    5. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     
    6. In Silico Identification of Epitopes in Mycobacterium avium subsp. paratuberculosis Proteins That Were Upregulated under Stress Conditions
    RB Gurung, AC Purdie, DJ Begg - Clinical and Vaccine , 2012 - Am Soc Microbiol
     

    Protein Summary

    N-terminal part has sequence similarity to predicted flavin-nucleotide-binding proteins (COG3467) and pyridoxamine 5`-phosphate oxidase protein family (Pfam01243). However, the residues corresponding to FMN-binding cleft are not conserved here indicating that this protein fold (SCOP: FMN-binding split barrel [50474]) is used here to perform functions other then proteins from Pfam01243. Residues in putative FMN-binding cleft are not conserved.

    Analysis of the crystallographic packing of NP_828636 using the PQS server {Henrick, 1998 #73} indicates that a dimer is the biologically relevant form.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch