.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ii1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal Structure of Acetamidase (10172637) from Bacillus Halodurans at 1.95 A Resolution. To be Published
    Site JCSG
    PDB Id 2ii1 Target Id 356726
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS1366,10172637, PF03069, 289674, 289690 Molecular Weight 31862.76 Da.
    Residues 300 Isoelectric Point 4.64
    Sequence mirlsnentiffmdkenvpiascqsgdtvifetkdcfsdqitneeqaltsidfnrvnpatgplyvegar rgdmleieildikvgkqgvmtaapglgalgeslnspttklfpiegddvvystglrlplqpmigvigtap pgepinngtpgphggnldtkdikpgttvylpvevdgallalgdlhaamgdgeilicgveiagtvtlkvn vkkermfplpalktdthfmtiasaetldaaavqatknmatflanrtalsieeagmllsgagdlyvsqiv nplktarfslalhyfeklgvdlcn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.95 Rfree 0.228
    Matthews' coefficent 2.15 Rfactor 0.175
    Waters 443 Solvent Content 42.27

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ii1
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. On the combination of molecular replacement and single-wavelength anomalous diffraction phasing for automated structure determination
    S Panjikar, V Parthasarathy, VS Lamzin - Section D: Biological , 2009 - scripts.iucr.org
     
    3. Crystal Structure Analysis of a Recombinant Predicted Acetamidase/Formamidase from the Thermophile Thermoanaerobacter tengcongensis
    M Qian, Q Huang, G Wu, L Lai, Y Tang, J Pei - The Protein , 2012 - Springer
     

    Protein Summary

    The 10172637 from B. halodurans belongs to Acetamidase/Formamidase protein family (PF03069) with homologs present in all kingdoms of life.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch