.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k87

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Nuclear magnetic resonance structure of the nucleic acid-binding domain of severe acute respiratory syndrome coronavirus nonstructural protein 3. J.Virol. 83 12998-13008 2009
    Site JCSG
    PDB Id 2k87 Target Id 396981
    Molecular Characteristics
    Source Sars coronavirus
    Alias Ids TPS20984,NP_828850.1 Molecular Weight 13082.24 Da.
    Residues 115 Isoelectric Point 8.83
    Sequence yteqpidlvptqplpnasfdnfkltcsntkfaddlnqmtgftkpasrelsvtffpdlngdvvaidyrhy sasfkkgakllhkpivwhinqattkttfkpntwclrclwstkpvdt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k87
    1. Nuclear magnetic resonance structure of the nucleic acid-binding domain of severe acute respiratory syndrome coronavirus nonstructural protein 3
    P Serrano, MA Johnson, A Chatterjee - Journal of , 2009 - Am Soc Microbiol
     
    2. Sequential nearest-neighbor effects on computed 13 C _ chemical shifts
    JA Vila, P Serrano, K Wthrich - Journal of biomolecular , 2010 - Springer
     

    Protein Summary

    The genomic region NP_828850.1 from Sars coronavirus translates into the Nsp3e domain of  the non-structural protein (Nsp) 3.  Nsp3 is the largest SARS nonstructural proteins. It is predicted to have multiple functional domains [Ref].  

    The 2k87 structure corresponds to residues 1066–1181 within the functional domain nsp3e.  The SCOP fold type assignment suggests that Nsp3e is a catalytic domain which belongs to the family of DNA ligase/mRNA capping enzyme, and adopts an ATP-grasp fold type (SCOP56058).

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch