.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kaf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title SARS coronavirus unique domain: three-domain molecular architecture in solution and RNA binding. J.Mol.Biol. 400 724-742 2010
    Site JCSG
    PDB Id 2kaf Target Id 399745
    Molecular Characteristics
    Source Sars coronavirus
    Alias Ids TPS24899,NP_828850.1 Molecular Weight 7529.01 Da.
    Residues 66 Isoelectric Point 4.98
    Sequence seehfvetvslagsyrdwsysgqrtelgveflkrgdkivyhtlespvefhldgevlsldklkslls
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kaf
    1. Modeling of the Toll_like receptor 3 and a putative Toll_like receptor 3 antagonist encoded by the African swine fever virus
    ES Henriques, RMM Brito, H Soares, S Ventura - Protein , 2011 - Wiley Online Library
     
    2. SARS coronavirus unique domain: three-domain molecular architecture in solution and RNA binding
    MA Johnson, A Chatterjee, BW Neuman - Journal of molecular , 2010 - Elsevier
     
    3. Supporting Science through the Interoperability of Data and Articles
    IJJ Aalbersberg, O Khler - D-Lib Magazine, 2011 - dialnet.unirioja.es
     

    Protein Summary

    The gene NP_828850.1 from Sars coronavirus encodes domain C of the SARS non-structural protein 3 (Nsp3c)(PF12124).  Nsp3 is the largest of the nonstructural proteins. It is predicted to have multiple functional domains.  The overall physiological role of the Nsp3 protein remains poorly understood.  The fold classification of this domain suggests that it could be a catalytic domain belonging to the DeoB insert-like family SCOP143855, which is the phosphopentomutase family of enzymes.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch